PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc09g074760.1.1
Common NameLOC101254635
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 139aa    MW: 15747.7 Da    PI: 5.3109
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc09g074760.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB174.79.4e-5520115297
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                         +e+d+flPianv+rimk++lP+nakisk+ ket+qecvsefisfvtseas+kc++ekrkt+ngdd++wa+++lGf+dyvepl+ yl++yre
  Solyc09g074760.1.1  20 KEHDKFLPIANVGRIMKHILPQNAKISKEGKETMQECVSEFISFVTSEASEKCHKEKRKTLNGDDICWAMGNLGFDDYVEPLNRYLHRYRE 110
                         799**************************************************************************************** PP

               NF-YB  93 legek 97 
                         legek
  Solyc09g074760.1.1 111 LEGEK 115
                         ***97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.4E-5115124IPR009072Histone-fold
SuperFamilySSF471131.1E-3823119IPR009072Histone-fold
PfamPF008084.6E-272589IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.0E-185371No hitNo description
PROSITE patternPS0068505672IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.0E-187290No hitNo description
PRINTSPR006151.0E-1891109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MVDTNNILGS FDSSEEGGFK EHDKFLPIAN VGRIMKHILP QNAKISKEGK ETMQECVSEF  60
ISFVTSEASE KCHKEKRKTL NGDDICWAMG NLGFDDYVEP LNRYLHRYRE LEGEKANQNK  120
VDIGNKNEES LLGRFYGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B9e-4518110294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A9e-4518110294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.239820.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004247445.11e-100PREDICTED: nuclear transcription factor Y subunit B-5
SwissprotO822486e-57NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLK4CV531e-100K4CV53_SOLLC; Uncharacterized protein
STRINGSolyc09g074760.1.11e-100(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.14e-58nuclear factor Y, subunit B5
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]